PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca55129.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 286aa    MW: 32037.3 Da    PI: 8.1319
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca55129.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA503.9e-16159193135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C++C  t+Tp+WR gpdg+ktLCnaCG+ y k g+
  Dca55129.1 159 CTHCEITQTPQWRCGPDGPKTLCNACGVLYMKSGR 193
                 ***************************99888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.136153196IPR000679Zinc finger, GATA-type
SMARTSM004013.1E-15153204IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.4E-14157193IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577168.08E-15157213No hitNo description
CDDcd002022.74E-12158208No hitNo description
PfamPF003201.3E-13159192IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MVKMEDVGSG KLFEHIDDLL DFANDDIDDD RLFGCGEVDI DAFPPVWIDD SPALFSSAPT  60
NNCTPRFEDS AQLEWLTNFV QDSLSKPKTH LMCHAKRARS KRPRPATFNP RAALHLIPPR  120
HFLKPKRKQK INCQCSSTSP DAETHKQNED PNAKPVRKCT HCEITQTPQW RCGPDGPKTL  180
CNACGVLYMK SGRLFPEYRP AASPTFIPTV HSNCLRKVVE MRKSKNEAET VKSDMLQNSI  240
SLEKHRELSK CKSANESLTS KDASPVKSAA NVEETVKTEA KTSCHS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100104KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683872.14e-63PREDICTED: GATA transcription factor 8
TrEMBLA0A0J8C2J74e-63A0A0J8C2J7_BETVU; Uncharacterized protein
STRINGVIT_13s0019g04390.t017e-54(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.23e-34GATA transcription factor 11